PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P02150_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bHLH
Protein Properties Length: 345aa    MW: 37940.3 Da    PI: 6.5124
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P02150_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.71.2e-09107137131
                            CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC. CS
                    HLH   1 rrrahnerErrRRdriNsafeeLrellPkas 31 
                            +r++h ++Er+RR+++N+ ++ L++l+P ++
  GSMUA_Achr6P02150_001 107 QRMTHIAVERNRRKQMNEYLAVLQSLMPASY 137
                            79**************************963 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.103.6E-12105141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.33E-6105203No hitNo description
SuperFamilySSF474592.38E-13106134IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.506106198IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.6E-7107136IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.38E-13176211IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.6E-12181203IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MALEAVALPQ DLFGCAMNEL YNMGGAAWCY AFGDEGEEKG VALDCKISGG GGGGVHGNLD  60
VSSGASSSLL ETAAKDGALV IGREATAGGR KRRRTKVFKN QEEVENQRMT HIAVERNRRK  120
QMNEYLAVLQ SLMPASYVQR LPLCVFVCAT FLISLRLMSS LWRIVFRASN SICIHIWSSF  180
RGDQASIIGG AINFVKELEQ LVQSLEARKR VEKRMDAAPF ADFFTFPQYS TTGSRSANND  240
CADEGATENR PAVADIEVTM VESHANLKVL SRRRPKQLLK MVLGLQNLRL TTLHLNVTSI  300
AEMAFYSFSL KVEDDCQLTS VDEIATAVHQ MVGTIQEDAD RDSNL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18993RKRRR
28994RKRRRT
3107118RMTHIAVERNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403078.10.0PREDICTED: transcription factor bHLH94-like
TrEMBLM0T3G30.0M0T3G3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P02150_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74138156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22490.13e-60bHLH family protein